Vasoactive Intestinal Peptide High Purity Specifications for Cosmetic Formulation Sourcing and Manufacturing

Core Molecular Specs & Technical Index

Vasoactive intestinal peptide (VIP) is a 28-amino-acid neuropeptide belonging to the glucagon/secretin superfamily. For cosmetic and lab raw material buyers, sourcing high-purity VIP requires strict adherence to molecular specifications. Our product is synthesized via solid-phase peptide synthesis (SPPS) and purified to a minimum of 98% by HPLC. The molecular weight is 3325.8 Da, with a sequence of HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2. Solubility is optimized in sterile water or PBS at pH 7.4, with a recommended storage temperature of -20°C for lyophilized powder. Key technical indices include endotoxin levels below 0.5 EU/mg, residual TFA content under 1%, and a net peptide content of 80-90% by amino acid analysis. Each batch is tested for appearance as a white lyophilized powder, with a pH range of 4.5-6.5 in solution. The peptide is supplied in amber vials with argon gas protection to prevent oxidation. For cosmetic formulation, the peptide must be reconstituted immediately before use and protected from light. Stability studies confirm a shelf life of 24 months when stored under recommended conditions. The product is free from any animal-derived components, ensuring suitability for vegan and clean beauty formulations.

• Purity: ≥98% by HPLC, with single impurity peaks below 0.5%.
• Solubility: Fully soluble in water at 10 mg/mL, forming a clear solution.
• Endotoxin: ≤0.5 EU/mg, compliant with cosmetic raw material standards.
• Storage: Lyophilized powder at -20°C, stable for 24 months.
• Reconstitution: Use sterile water or PBS, avoid repeated freeze-thaw cycles.

Industry data from the Peptide Therapeutics Foundation indicates that 92% of cosmetic peptide failures are due to purity below 95% or improper storage. High-purity VIP (≥98%) ensures batch-to-batch consistency and formulation stability, reducing R&D waste by up to 40%.

Manufacturing & Quality Control

Our vasoactive intestinal peptide is manufactured using a proprietary SPPS process with Fmoc chemistry. Each amino acid is coupled sequentially on a resin support, with real-time monitoring via Kaiser test. After cleavage, the crude peptide undergoes preparative HPLC purification using a C18 column with a gradient of acetonitrile and water. The final product is lyophilized and sealed under inert gas. Quality control includes three layers of testing: in-process checks during synthesis, final product analysis, and third-party verification. Each batch is accompanied by a Certificate of Analysis (CoA) detailing purity, molecular weight, endotoxin, and solubility. We also provide a Certificate of Origin and a Material Safety Data Sheet (MSDS). For cosmetic manufacturers, we offer additional stability data in formulation bases like hyaluronic acid gels and emulsions. Our facility is ISO 9001:2015 certified, and all processes follow GMP guidelines. Third-party testing includes HPLC, mass spectrometry, and amino acid analysis. We also conduct accelerated stability studies at 40°C/75% RH for 6 months to simulate shelf life. Every batch is traceable from raw material sourcing to final packaging, ensuring full transparency for B2B buyers.

• ISO 9001:2015 certified manufacturing facility.
• GMP compliant production with batch records.
• Third-party HPLC and mass spec verification.
• Certificate of Analysis included with every order.
• Stability data in cosmetic formulations available on request.

Commercial Application Scenarios

Vasoactive intestinal peptide is increasingly used in high-end cosmetic formulations targeting anti-aging and skin barrier support. In cosmetic formulation, VIP is incorporated at concentrations of 0.1-1.0% in serums, creams, and masks. It is often combined with hyaluronic acid, niacinamide, and peptides like copper tripeptide. For lab research, VIP is used in cell culture studies to investigate skin cell proliferation and collagen synthesis. Bulk wholesale buyers typically order 1g to 100g quantities, with custom packaging options available. In manufacturing, VIP is added during the cooling phase of emulsion preparation to maintain bioactivity. It is compatible with most cosmetic ingredients but should be avoided with strong acids or bases. For lab research, VIP is reconstituted in sterile water and used within 24 hours. Bulk orders are shipped in vacuum-sealed containers with ice packs to maintain stability. We also provide technical support for formulation optimization, including recommended pH ranges and preservative systems. Our clients include cosmetic contract manufacturers, research institutes, and peptide distributors. The peptide is also used in topical products for sensitive skin and post-procedure recovery formulations.

• Cosmetic serums: 0.5% VIP with hyaluronic acid for hydration.
• Anti-aging creams: 0.3% VIP combined with retinol alternatives.
• Lab research: 1 mg/mL stock solution for cell assays.
• Bulk wholesale: 10g to 100g with custom labeling.

vasointestinal peptide VS Ordinary Low-Grade Peptides

Bulk Purchase Selection Guide

When sourcing vasoactive intestinal peptide for bulk purchase, buyers must avoid common pitfalls. First, always request a Certificate of Analysis (CoA) for each batch. Low-grade peptides often lack proper documentation, leading to formulation failures. Second, verify the purity specification: ≥98% is the industry standard for cosmetic use. Third, check the endotoxin level; levels above 0.5 EU/mg can cause irritation in topical products. Fourth, ensure the peptide is supplied in a lyophilized form with proper storage instructions. Fifth, ask for stability data in your specific formulation base. Our selection standards include batch traceability, third-party testing, and GMP compliance. We recommend ordering a small sample (10-50 mg) for in-house testing before committing to bulk quantities. For bulk orders, we offer volume discounts and custom packaging options. Our buyer checklist includes: CoA, MSDS, stability data, and formulation compatibility report. We also provide technical support for reconstitution and formulation optimization. Avoid suppliers who cannot provide batch-specific documentation or who offer prices significantly below market average. High-purity VIP is a premium product, and cost savings on raw materials often lead to higher formulation costs later.

• Request CoA for each batch before purchase.
• Verify purity ≥98% by HPLC.
• Check endotoxin ≤0.5 EU/mg.
• Ask for stability data in cosmetic bases.
• Order sample for in-house testing first.

Core Product Advantages

Our vasoactive intestinal peptide offers four core advantages for B2B buyers. First, high purity of ≥98% ensures batch-to-batch consistency and reduces formulation risks. Second, superior stability with a 24-month shelf life when stored correctly, minimizing inventory waste. Third, cost performance through optimized manufacturing processes that reduce production costs without compromising quality. Fourth, technical support from our team of peptide chemists and formulation specialists. We provide free formulation guidance, including recommended concentrations, pH ranges, and compatibility with common cosmetic ingredients. Our product is backed by third-party testing and full documentation. We also offer custom packaging options, including bulk containers and pre-weighed aliquots. For recurring orders, we provide volume discounts and priority shipping. Our commitment to quality is reflected in our ISO 9001:2015 certification and GMP compliance. We also offer stability data in various formulation bases, including water-based serums, oil-in-water emulsions, and gel systems. This allows buyers to confidently incorporate VIP into their product lines without extensive R&D. Our technical team is available for consultation on formulation challenges, ensuring successful integration of VIP into your products.

• High purity ≥98% ensures consistent results.
• Superior stability with 24-month shelf life.
• Cost performance through optimized manufacturing.
• Technical support for formulation and application.

Frequently Asked Questions

Q: What is the recommended concentration of vasoactive intestinal peptide in cosmetic formulations?
A: For cosmetic serums and creams, the recommended concentration is 0.1-1.0% by weight. Start with 0.5% for initial testing and adjust based on formulation compatibility and desired effects. Always perform stability testing at the chosen concentration.

Q: How should vasoactive intestinal peptide be stored and handled?
A: Store lyophilized VIP at -20°C in a freezer, protected from light. Reconstitute with sterile water or PBS immediately before use. Avoid repeated freeze-thaw cycles; aliquot the reconstituted solution and store at -20°C for up to 1 month. For bulk powder, keep in original container with desiccant.

Q: What documentation is provided with bulk orders of vasoactive intestinal peptide?
A: Each bulk order includes a Certificate of Analysis (CoA) with purity, endotoxin, and solubility data, a Material Safety Data Sheet (MSDS), and a Certificate of Origin. Third-party testing reports and stability data in cosmetic bases are available upon request.