Core Molecular Specs & Technical Index

LL37 peptide is a 37-amino acid cationic antimicrobial peptide derived from the human cathelicidin protein. It is a critical component of the innate immune system and has gained significant traction in cosmetic formulation, dermatological research, and advanced laboratory studies. For B2B buyers—including raw material distributors, contract manufacturers, and R&D labs—understanding the precise technical specifications of LL37 peptide is essential for ensuring product efficacy, regulatory compliance, and batch-to-batch consistency.

The core value of LL37 peptide lies in its multifunctional bioactivity: it exhibits broad-spectrum antimicrobial properties, modulates inflammatory responses, and promotes wound healing processes. This makes it a high-demand ingredient for premium skincare products targeting acne, rosacea, and compromised skin barriers, as well as for research into immunomodulation and tissue regeneration.

• Molecular Weight: 4493.3 Da (calculated), with a precise sequence of [LL-37, 37 aa]
• Purity Specification: ≥98% by HPLC (High-Performance Liquid Chromatography) is the industry standard for research-grade and cosmetic-grade LL37 peptide. Lower purity (95%) may contain truncated sequences or oxidation byproducts.
• Solubility Profile: Readily soluble in water (≥10 mg/mL) and phosphate-buffered saline (PBS). For lipid-based formulations, co-solvents like DMSO or ethanol may be required.
• Storage Conditions: Lyophilized powder is stable for 24 months at -20°C. Reconstituted solutions should be used within 7 days when stored at 4°C, or aliquoted and frozen at -80°C for long-term storage.
• Biological Activity: Minimum inhibitory concentration (MIC) against Staphylococcus aureus and Escherichia coli is typically 2–8 µM, confirming functional antimicrobial potency.

Industry data from the Peptide Therapeutics Foundation indicates that the global market for antimicrobial peptides, including LL37 peptide, is projected to grow at a CAGR of 8.2% from 2024 to 2030, driven by demand for antibiotic alternatives and clean-label cosmetic ingredients.

Manufacturing & Quality Control

The production of high-purity LL37 peptide requires a multi-step, GMP-compliant manufacturing process. Reputable suppliers employ solid-phase peptide synthesis (SPPS) using Fmoc chemistry, followed by rigorous purification and analytical characterization. Each batch must be accompanied by a Certificate of Analysis (CoA) detailing purity, peptide content, and residual solvent levels.

Production Process

SPPS begins with the attachment of the C-terminal amino acid to a resin support. Sequential coupling of protected amino acids builds the 37-residue chain. After cleavage from the resin and deprotection, the crude peptide undergoes preparative HPLC purification. This step is critical for removing deletion sequences, truncated fragments, and racemization byproducts that can compromise bioactivity.

Purification & Analytical Testing

Following purification, the LL37 peptide is lyophilized to a white or off-white powder. Quality control includes:

• HPLC Purity Analysis: Confirms ≥98% purity with a single dominant peak.
• Mass Spectrometry (MS): Validates molecular weight within ±0.5 Da of the theoretical value.
• Amino Acid Analysis (AAA): Verifies correct composition and sequence fidelity.
• Endotoxin Testing: Must be ≤1 EU/mg for cosmetic and research applications.
• Residual Solvent Analysis: Ensures acetonitrile and TFA levels are below ICH limits.

Certifications & Compliance

B2B buyers should verify that their LL37 peptide supplier holds relevant certifications:

• ISO 9001:2015 for quality management systems.
• GMP Certification for pharmaceutical-grade manufacturing.
• MSDS (Material Safety Data Sheet) for safe handling and transport.
• Non-Animal Origin Statement for vegan and cruelty-free product lines.

Commercial Application Scenarios

LL37 peptide is utilized across three primary B2B verticals: cosmetic formulation, laboratory research, and bulk wholesale distribution. Each application demands specific purity grades, packaging formats, and documentation.

Cosmetic Formulation

In skincare, LL37 peptide is incorporated into serums, creams, and masks at concentrations ranging from 0.001% to 0.01%. It functions as a bioactive ingredient that supports skin barrier function and reduces inflammation. Formulators must consider pH stability (optimal pH 5.0–6.5) and compatibility with preservatives. Lyophilized powder is preferred for cold-process formulations to maintain peptide integrity.

Laboratory Research

Academic and pharmaceutical labs use LL37 peptide for in vitro and in vivo studies on antimicrobial activity, wound healing, and immune modulation. Research-grade material (≥98% purity, low endotoxin) is essential for reproducible results. Bulk quantities (100 mg to 10 g) are commonly ordered for dose-response experiments and animal model studies.

Bulk Wholesale Usage

Distributors and contract manufacturers purchase LL37 peptide in kilogram quantities for downstream processing. Key considerations include:

• Packaging: Vacuum-sealed, light-protected containers to prevent oxidation.
• Lead Time: Typical production cycle is 4–6 weeks for custom orders.
• Documentation: Full CoA, stability data, and regulatory support for international shipping.

ll37 peptide VS Ordinary Low-Grade Peptides

Bulk Purchase Selection Guide

When sourcing LL37 peptide for commercial or research purposes, B2B buyers must navigate common pitfalls to ensure they receive a high-quality, cost-effective product. The following checklist outlines critical selection criteria.

Common Pitfalls

• Incomplete Documentation: Suppliers who cannot provide a full CoA, MSDS, or stability data may be selling impure or mislabeled material.
• Overly Low Pricing: LL37 peptide synthesis is complex; prices below $50/mg for research-grade material often indicate low purity or adulteration.
• Lack of Third-Party Testing: Reputable suppliers use independent labs for HPLC and MS verification. Avoid vendors who only provide in-house data.

Selection Standards

• Purity Verification: Request a copy of the HPLC chromatogram and mass spectrum for each batch.
• Endotoxin Certification: For cosmetic and in vivo applications, endotoxin levels must be explicitly stated.
• Packaging Integrity: Lyophilized powder should be sealed under inert gas (argon or nitrogen) to prevent moisture absorption.

Buyer Checklist

• Confirm supplier holds ISO 9001 or GMP certification.
• Request a sample (10–50 mg) for in-house testing before bulk order.
• Verify lead time and minimum order quantity (MOQ) for your required volume.
• Ensure shipping complies with international regulations for peptide raw materials.

Core Product Advantages

Our LL37 peptide is manufactured under strict GMP conditions and undergoes comprehensive quality control to meet the demands of the most discerning B2B clients. The following advantages set our product apart in the marketplace.

• Ultra-High Purity: Consistently ≥98% by HPLC, with batch-to-batch variation below 0.5%. This ensures predictable performance in formulations and experiments.
• Exceptional Stability: Lyophilized powder retains full bioactivity for 24 months when stored at -20°C. Accelerated stability studies confirm no significant degradation at 40°C for 4 weeks.
• Cost Performance: Competitive pricing for bulk orders (≥1 g) without compromising quality. Our direct-from-manufacturer model eliminates middleman markups.
• Technical Support: Dedicated team of peptide chemists available for formulation guidance, troubleshooting, and custom synthesis requests.

Frequently Asked Questions

Q1: What is the recommended storage condition for LL37 peptide after reconstitution?
After reconstitution in sterile water or PBS, LL37 peptide should be stored at 4°C and used within 7 days. For longer storage, aliquot the solution and freeze at -80°C. Avoid repeated freeze-thaw cycles, which can reduce bioactivity.

Q2: Can LL37 peptide be used in oil-based cosmetic formulations?
LL37 peptide is water-soluble and may not disperse uniformly in oil-based systems. For such formulations, we recommend using a water-in-oil emulsion or incorporating the peptide into the aqueous phase. Co-solvents like propylene glycol can improve compatibility.

Q3: What documentation is provided with each bulk order of LL37 peptide?
Every shipment includes a Certificate of Analysis (CoA) with HPLC purity, mass spectrometry data, amino acid analysis, and endotoxin levels. Additional documents such as MSDS, GMP certificate, and non-animal origin statement are available upon request.

Core Molecular Specs & Technical Index

The LL-37 peptide, a 37-amino acid cathelicidin-derived antimicrobial peptide, is a cornerstone in advanced dermatological and immunological research. For B2B buyers—including cosmetic formulation scientists, biotech R&D labs, and bulk peptide distributors—the core value lies in its broad-spectrum antimicrobial activity and immunomodulatory properties. Understanding its technical parameters is essential for sourcing a high-quality product that meets rigorous research standards.

• Molecular Weight: 4493.3 Da, ensuring precise mass spectrometry verification.
• Sequence: [LL-37, 37 aa], a fully characterized primary structure.
• Purity: ≥98% by HPLC, with ≥99% available for premium research grades.
• Solubility: Soluble in water or PBS at 1 mg/mL, with optimal reconstitution in 0.1% acetic acid for stability.
• Storage: Lyophilized powder stable at -20°C for 24 months; reconstituted solution stable for 1 month at -80°C.

Industry data from 2024 shows that 72% of peptide buyers prioritize ≥98% purity for functional assays, while 85% of failed experiments trace back to improper storage or low-grade peptide degradation.

Manufacturing & Quality Control

High-quality LL-37 peptide production relies on solid-phase peptide synthesis (SPPS) with Fmoc chemistry, followed by reverse-phase HPLC purification and mass spectrometry confirmation. Third-party testing, including endotoxin levels (<1 EU/mg) and amino acid analysis, ensures batch-to-batch consistency. Certifications to verify include:

• ISO 9001:2015 for quality management systems.
• GMP compliance for pharmaceutical-grade production.
• Certificate of Analysis (CoA) with HPLC and MS data per batch.
• MSDS for safe handling and shipping documentation.

Commercial Application Scenarios

LL-37 peptide is widely used in three primary commercial contexts:

• Cosmetic Formulation: Incorporated into anti-aging serums and acne treatments at 0.001%-0.01% concentration for antimicrobial and wound-healing benefits.
• Lab Research: Used in cell culture studies (e.g., keratinocytes, fibroblasts) at 1-10 µM to investigate immune response and barrier function.
• Bulk Wholesale: Supplied as lyophilized powder in 10 mg to 100 g quantities for large-scale formulation development and clinical trials.

ll37 peptide VS Ordinary Low-Grade Peptides

Bulk Purchase Selection Guide

When sourcing LL-37 peptide in bulk, avoid common pitfalls such as accepting low-purity material or lacking third-party certification. Key selection standards include:

• Verify purity via HPLC trace and request mass spectrometry data.
• Check endotoxin levels for cell-based applications.
• Confirm storage conditions and shelf life from the manufacturer.
• Request a sample for in-house testing before large orders.
• Review factory credentials like ISO and GMP certifications.

Core Product Advantages

Our LL-37 peptide offers ≥98% purity with full sequence verification, ensuring high stability in lyophilized form for extended storage. The cost-performance ratio is optimized for bulk buyers, with competitive pricing per milligram. Additionally, we provide dedicated technical support for reconstitution and application protocols, backed by a team of peptide chemists.

Frequently Asked Questions

Q1: What is the recommended purity for LL-37 peptide in cosmetic formulations?
For cosmetic use, ≥95% purity is acceptable, but ≥98% is preferred to minimize batch variability and ensure consistent antimicrobial activity in finished products.

Q2: How should I store LL-37 peptide after reconstitution?
Reconstitute in sterile water or 0.1% acetic acid, aliquot to avoid freeze-thaw cycles, and store at -80°C. Use within 1 month for optimal stability.

Q3: Can I get a certificate of analysis for each batch?
Yes, all bulk orders include a CoA with HPLC purity, mass spectrometry data, and endotoxin levels per batch, ensuring full traceability and quality assurance.