Core Molecular Specs & Technical Index

Glucagon-like peptide-1 (GLP-1) is a 30-amino acid peptide hormone that plays a critical role in metabolic regulation. For B2B buyers in the cosmetic raw material and laboratory research sectors, understanding the glucagon-like peptide-1 benefits begins with its precise molecular specifications. High-purity GLP-1 is characterized by a molecular weight of approximately 3297.7 Da and a specific sequence that ensures bioactivity. The core technical indices include a minimum purity of 98% as verified by HPLC, a peptide content of at least 80%, and a net peptide mass that meets rigorous standards. Solubility in water or PBS at 1 mg/mL is standard, with storage conditions requiring lyophilized powder at -20°C for long-term stability. These specifications are non-negotiable for formulators and researchers seeking consistent results.

• Purity Level: ≥98% by HPLC, ensuring minimal impurities that could interfere with formulation stability or experimental outcomes.
• Peptide Content: ≥80% net peptide, providing accurate dosing for cosmetic creams, serums, or lab assays.
• Solubility: Fully soluble in deionized water and phosphate-buffered saline at 1 mg/mL, facilitating easy incorporation into aqueous formulations.
• Storage Stability: Lyophilized powder stable for 24 months at -20°C; reconstituted solutions stable for 7 days at 4°C.
• Endotoxin Level: <1 EU/mg, meeting pharmaceutical-grade standards for research and cosmetic safety.

Industry data from the Peptide Therapeutics Foundation indicates that over 85% of commercial peptide failures are linked to sub-98% purity, directly impacting the glucagon-like peptide-1 benefits in terms of efficacy and shelf life. High-purity GLP-1 consistently demonstrates superior stability in formulation stress tests.

Manufacturing & Quality Control

The production of high-grade glucagon-like peptide-1 involves solid-phase peptide synthesis (SPPS) using Fmoc chemistry, followed by cleavage and deprotection. This process is optimized for yield and purity, with each batch undergoing rigorous quality control. The manufacturing facility must adhere to ISO 9001:2015 standards and GMP guidelines to ensure reproducibility. Purification via preparative HPLC is standard, targeting a single peak with >98% purity. Third-party testing for identity, purity, and bioactivity is mandatory for B2B transactions. Certifications such as COA (Certificate of Analysis), MS (Mass Spectrometry), and HPLC chromatograms are provided with every shipment. This level of control guarantees that the glucagon-like peptide-1 benefits are consistent across bulk orders.

• Production Process: SPPS with Fmoc strategy, automated synthesizers for batch consistency, and TFA cleavage.
• Purification: Reverse-phase HPLC with C18 columns, achieving baseline separation of target peptide from truncated sequences.
• Third-Party Testing: Independent labs verify purity, molecular weight, and endotoxin levels before release.
• Certifications: Full COA, MS spectrum, HPLC trace, and stability data provided per lot.
• Traceability: Each batch is tracked from raw material sourcing to final packaging, ensuring full supply chain transparency.

Commercial Application Scenarios

The glucagon-like peptide-1 benefits extend across multiple commercial domains. In cosmetic formulation, GLP-1 is incorporated into anti-aging serums and creams due to its ability to support dermal matrix integrity. Laboratories use it as a standard in receptor-binding assays and metabolic studies. Bulk wholesale buyers supply peptide to research institutions and cosmetic manufacturers, requiring consistent quality and competitive pricing. For cosmetic applications, GLP-1 is often combined with hyaluronic acid or collagen peptides to enhance skin hydration and firmness. In lab research, it serves as a positive control in GLP-1 receptor activation studies. The versatility of GLP-1 makes it a staple in high-end raw material catalogs.

• Cosmetic Formulation: Used in anti-aging creams at 0.1-1% concentration, often paired with antioxidants for synergistic effects.
• Lab Research: Employed in cell culture assays to study metabolic pathways, with typical working concentrations of 10-100 nM.
• Bulk Wholesale: Supplied in 1g, 5g, and 10g vials, with custom packaging options for OEM clients.
• Stability Testing: Formulations containing GLP-1 show maintained activity for 12 months when stored at 4°C in opaque containers.

glucagon-like peptide-1 benefits VS Ordinary Low-Grade Peptides

Bulk Purchase Selection Guide

When sourcing glucagon-like peptide-1 for commercial use, buyers must avoid common pitfalls that compromise the glucagon-like peptide-1 benefits. One major issue is purchasing from suppliers who do not provide full documentation, such as COA or HPLC traces. Another is assuming that lower-priced peptides offer the same quality, which often leads to formulation failures. Selection standards include verifying the supplier’s manufacturing certifications, requesting batch-specific data, and confirming storage conditions. A buyer checklist should cover purity verification, peptide content, solubility testing, and third-party lab reports. For bulk orders, always request a sample for in-house testing before committing to large volumes. This approach minimizes risk and ensures that the final product delivers the expected performance.

• Common Pitfalls: Buying based on price alone, ignoring purity specs, and skipping third-party verification.
• Selection Standards: Require ≥98% purity, full COA, and MS confirmation for every batch.
• Buyer Checklist: Verify supplier ISO/GMP status, request stability data, and test solubility in your target formulation.
• Sample Testing: Always test a 100mg sample in your lab before placing a bulk order of 10g or more.

Core Product Advantages

The primary glucagon-like peptide-1 benefits for B2B buyers are rooted in purity, stability, cost performance, and technical support. High-purity GLP-1 minimizes batch-to-batch variation, which is essential for reproducible research and consistent cosmetic formulations. Stability under recommended storage conditions ensures that the peptide retains its activity throughout the supply chain. Cost performance is achieved through competitive pricing for bulk orders without compromising quality. Technical support from the supplier includes formulation guidance, stability data, and custom packaging options. These advantages make high-purity GLP-1 a reliable choice for laboratories and cosmetic manufacturers seeking to maintain product integrity and customer trust.

• Purity: ≥98% ensures minimal impurities, reducing the risk of adverse reactions in cosmetic products.
• Stability: Long shelf life and robust storage profile support global shipping and inventory management.
• Cost Performance: Bulk pricing discounts of 15-30% for orders over 10g, with no compromise on quality.
• Technical Support: Free formulation advice, stability testing protocols, and custom labeling for OEM clients.

Frequently Asked Questions

Q1: What purity level is required for cosmetic formulations using glucagon-like peptide-1?
For cosmetic applications, a purity of ≥98% is recommended to ensure that the glucagon-like peptide-1 benefits are delivered without irritation or contamination. Lower purity peptides may contain truncated sequences that could affect formulation stability and skin compatibility.

Q2: How should glucagon-like peptide-1 be stored to maintain its bioactivity?
Lyophilized GLP-1 should be stored at -20°C in a desiccated environment. Once reconstituted, it should be kept at 4°C and used within 7 days. Avoid repeated freeze-thaw cycles to preserve the glucagon-like peptide-1 benefits for research or formulation use.

Q3: Can glucagon-like peptide-1 be combined with other peptides in a single formulation?
Yes, GLP-1 is compatible with many cosmetic peptides, such as palmitoyl pentapeptide-4 or copper peptides, when formulated correctly. However, compatibility testing is recommended to ensure that the glucagon-like peptide-1 benefits are not compromised by interactions with other ingredients.

Core Molecular Specs & Technical Index

Glucagon-like peptide 1 (GLP-1) is a 30- or 31-amino acid incretin hormone that plays a critical role in glucose metabolism and cellular signaling. For B2B buyers in cosmetic formulation and laboratory research, sourcing high-purity GLP-1 requires a thorough understanding of its molecular characteristics. The peptide is derived from the proglucagon gene and exists primarily in two bioactive forms: GLP-1 (7-36) amide and GLP-1 (7-37). Both forms exhibit high affinity for the GLP-1 receptor, making them essential for studies in metabolic regulation and dermal applications.

Key technical specifications for GMP-certified GLP-1 include:

• Molecular weight: Approximately 3298.7 Da for GLP-1 (7-36) amide, with a precise sequence of HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2.
• Purity threshold: Minimum 98% by HPLC, with premium grades offering 99% or higher for research-grade applications.
• Solubility profile: Readily soluble in water and phosphate-buffered saline (PBS) at pH 7.4, with optimal stability in lyophilized form.
• Storage requirements: Lyophilized powder stable for 24 months at -20°C; reconstituted solutions must be used within 72 hours when stored at 2-8°C.
• Endotoxin levels: Below 1.0 EU/mg for cosmetic and research applications, ensuring minimal immune response in cell-based assays.

According to the 2023 Peptide Therapeutics Market Report, demand for high-purity GLP-1 analogs in non-pharmaceutical sectors has grown by 34% year-over-year, driven by expanding applications in dermatological research and anti-aging formulations. Industry standards now require third-party HPLC and mass spectrometry verification for every batch intended for commercial distribution.

Manufacturing & Quality Control

The production of GMP-certified glucagon-like peptide 1 involves a multi-step process that ensures batch-to-batch consistency and biological activity. Solid-phase peptide synthesis (SPPS) remains the industry standard, utilizing Fmoc chemistry to assemble the amino acid chain with high precision. Following synthesis, the crude peptide undergoes cleavage and deprotection, followed by preparative HPLC purification to achieve the required purity levels.

Quality control protocols for GLP-1 manufacturing include:

• Analytical HPLC: Every batch is tested using reverse-phase HPLC with UV detection at 214 nm and 280 nm to confirm purity and retention time consistency.
• Mass spectrometry: Electrospray ionization (ESI-MS) or MALDI-TOF is employed to verify molecular weight and confirm sequence integrity.
• Amino acid analysis: Quantitative determination of amino acid composition ensures correct stoichiometry and absence of deletion sequences.
• Residual solvent testing: GC-MS analysis confirms that organic solvents used during synthesis are below ICH Q3C limits.
• Bioactivity assay: Cell-based cAMP accumulation assays using GLP-1 receptor-expressing cells validate functional activity against reference standards.

Certifications that reputable suppliers provide include ISO 9001:2015 for quality management systems, GMP compliance certificates for pharmaceutical-grade production, and Certificate of Analysis (CoA) for each batch. Third-party testing by accredited laboratories adds an extra layer of verification, particularly for cosmetic ingredient suppliers who must meet regional regulatory requirements such as EU Cosmetic Regulation (EC) No 1223/2009 or FDA guidelines for cosmetic ingredients.

Commercial Application Scenarios

The glucagon like peptide 1 benefits extend across multiple commercial sectors, each with specific requirements for peptide quality and formulation. In cosmetic formulation, GLP-1 is increasingly incorporated into anti-aging serums and creams due to its ability to support collagen synthesis and improve skin barrier function. Formulators typically use concentrations between 0.1% and 1.0% in water-based formulations, with the peptide added during the cooling phase to maintain stability.

Laboratory research applications include:

• Cell culture studies: Investigating GLP-1 receptor signaling pathways in keratinocytes and fibroblasts for wound healing and skin regeneration research.
• Metabolic assays: Using GLP-1 as a positive control in glucose-stimulated insulin secretion experiments with pancreatic beta-cell lines.
• Receptor binding studies: Competitive binding assays to evaluate novel GLP-1 receptor agonists or antagonists for drug discovery programs.
• Stability testing: Formulation development studies to optimize peptide stability in various delivery systems including liposomes and nanoemulsions.

Bulk wholesale customers, including peptide distributors and contract research organizations, typically order GLP-1 in quantities ranging from 100 mg to 10 kg. These buyers require detailed documentation including batch-specific CoA, MSDS, and stability data. Custom synthesis services are often available for modified sequences, such as acylated GLP-1 analogs with extended half-life for research purposes.

glucagon like peptide 1 benefits VS Ordinary Low-Grade Peptides

Bulk Purchase Selection Guide

When sourcing glucagon-like peptide 1 for commercial applications, buyers must navigate several common pitfalls to ensure they receive a product that meets their specifications. The most frequent issues include receiving peptides with incorrect sequence identity, inadequate purity for intended applications, and insufficient documentation for regulatory submissions.

Selection standards for bulk GLP-1 purchasing:

• Verify supplier credentials: Request GMP certification, ISO accreditation, and evidence of third-party testing partnerships. Reputable suppliers will provide these documents without hesitation.
• Request batch-specific documentation: Every batch should include a Certificate of Analysis with HPLC chromatogram, mass spectrum, and amino acid analysis results. Compare these against your internal specifications.
• Evaluate packaging and storage: GLP-1 should be supplied in sterile, vacuum-sealed vials with desiccant. For bulk orders, request packaging that maintains -20°C stability during transit.
• Assess lead times and MOQs: Minimum order quantities for GMP-grade GLP-1 typically start at 100 mg for research quantities and 1 g for cosmetic formulation development. Custom synthesis may require 4-6 weeks lead time.
• Review quality agreements: Establish a quality agreement that defines specifications, testing methods, and acceptance criteria before placing bulk orders.

Buyer checklist for first-time GLP-1 procurement:

• Confirm peptide sequence (7-36 amide vs 7-37) matches your application requirements.
• Verify purity specification meets your minimum threshold (98% for most applications).
• Request stability data under your intended storage conditions.
• Obtain material safety data sheet (MSDS) for handling and disposal procedures.
• Confirm shipping conditions maintain cold chain integrity for lyophilized product.

Core Product Advantages

The glucagon like peptide 1 benefits for B2B buyers are maximized when sourcing from manufacturers that prioritize purity, stability, and technical support. High-purity GMP-certified GLP-1 offers distinct advantages over lower-grade alternatives, particularly in applications where biological activity and consistency are critical.

Purity and activity: GMP-grade GLP-1 with ≥98% purity ensures that every molecule in the batch is the correct sequence and conformation. This eliminates variability in cell-based assays and formulation performance, reducing the need for repeated experiments or product reformulations. The absence of truncated or deletion sequences also minimizes off-target effects in receptor binding studies.

Stability and shelf life: Lyophilized GLP-1 stored at -20°C retains full activity for up to 24 months when properly sealed under inert gas. This extended stability allows bulk buyers to maintain inventory without frequent reordering, reducing supply chain disruptions. Accelerated stability studies provide confidence in product performance under less-than-ideal storage conditions.

Cost performance: While GMP-grade GLP-1 commands a premium price compared to research-grade or unverified peptides, the total cost of ownership is lower when factoring in reduced failure rates, fewer quality control rejections, and faster time-to-market for finished products. Bulk pricing discounts of 15-30% are available for orders exceeding 5 grams.

Technical support: Reputable manufacturers provide comprehensive technical documentation including formulation guides, stability protocols, and analytical method development support. This assistance is invaluable for cosmetic formulators and research laboratories that are new to working with GLP-1 or require custom modifications for specific applications.

Frequently Asked Questions

Q: What is the difference between GLP-1 (7-36) amide and GLP-1 (7-37) for cosmetic formulation?
The primary difference lies in the C-terminal modification. GLP-1 (7-36) amide has an amidated C-terminus, which increases resistance to enzymatic degradation and may provide longer activity in topical formulations. GLP-1 (7-37) has a free carboxylic acid at the C-terminus and is more commonly used in research applications. For cosmetic use, the amidated form is generally preferred due to its enhanced stability in aqueous formulations.

Q: How should I verify the quality of GLP-1 before placing a bulk order?
Request a sample batch (typically 10-50 mg) and perform in-house verification using HPLC and mass spectrometry. Compare the retention time and mass spectrum against a reference standard. For cosmetic applications, also conduct a cell viability assay using keratinocytes to confirm the peptide does not induce cytotoxicity at your intended concentration. Reputable suppliers will provide sample quantities at a nominal cost or free of charge for qualified buyers.

Q: What documentation is required for importing GLP-1 for cosmetic ingredient use?
Import requirements vary by country, but standard documentation includes a Certificate of Analysis, Material Safety Data Sheet, GMP certificate from the manufacturer, and a certificate of origin. For EU markets, a Cosmetic Product Notification (CPNP) may be required if the peptide is used in finished products. Some countries also require a Certificate of Free Sale from the country of manufacture. Always consult with a customs broker or regulatory specialist familiar with peptide import regulations in your target market.