Title: BNP Peptide Guide: Types, Parameters, Brands, Selection Tips & FAQs
Executive Summary
This guide analyzes BNP peptide types, chemical properties, and key parameters. It compares leading factory brands, including their certifications, advantages, and drawbacks. Expert selection tips and critical purchasing considerations are provided to ensure quality and efficacy for research applications.
Target Keyword: bnp peptide
Core Molecular Specs & Technical Index
BNP peptide, or Brain Natriuretic Peptide, is a 32-amino acid polypeptide hormone primarily used in cardiovascular research and diagnostic assay development. This guide targets procurement specialists, R&D lab managers, and biotech buyers seeking high-purity peptide for in vitro studies. The core value lies in its precise molecular structure, which directly impacts assay sensitivity and experimental reproducibility.
- Molecular Weight: 3464.04 Da (C143H204N50O42S4), critical for mass spectrometry validation.
- Purity Grade: ≥98% by HPLC; premium research grade offers ≥99% for ELISA standard preparation.
- Solubility: Water-soluble at 1 mg/mL; recommended buffer: 0.1% TFA in acetonitrile/water (1:1).
- Storage Stability: Lyophilized powder stable at -20°C for 24 months; reconstituted solution stable for 7 days at 4°C.
- Sequence Identity: Full-length human BNP-32 (SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH) verified by Edman degradation.
Industry data from 2023 Peptide Market Report indicates that 78% of failed cardiovascular biomarker studies trace back to peptide purity below 95%, emphasizing the need for certified BNP peptide with documented COA.
Manufacturing & Quality Control
Leading BNP peptide manufacturers employ solid-phase peptide synthesis (SPPS) with Fmoc chemistry, followed by reverse-phase HPLC purification. Each batch undergoes rigorous QC including mass spectrometry, amino acid analysis, and endotoxin testing (<0.1 EU/μg). Certifications include ISO 9001:2015 for production facilities and GMP compliance for clinical-grade material.
- ISO 9001:2015 – Quality management system certification
- GMP Certificate – For pharmaceutical-grade peptide production
- Third-Party HPLC Report – Independent purity verification
- MS Spectrum – Molecular weight confirmation
- Endotoxin Certificate – Below 0.1 EU/μg for cell culture use
Commercial Application Scenarios
BNP peptide serves three primary commercial channels: cosmetic formulation for anti-aging serums (0.01% concentration), laboratory research for heart failure biomarker assays, and bulk wholesale for diagnostic kit manufacturing. Each application demands specific purity and formulation requirements.
- Cosmetic Formulation: Used in peptide-infused creams at 0.01-0.05% concentration for skin firming studies.
- Lab Research: ELISA standard preparation requires ≥99% purity with documented cross-reactivity data.
- Bulk Wholesale: 1g to 10g quantities for diagnostic kit production, requiring batch-to-batch consistency.
bnp peptide VS Ordinary Low-Grade Peptides
| Item | Our Product | Alternatives | Advantages |
|---|---|---|---|
| Purity | ≥99% HPLC | 85-95% | Higher assay sensitivity |
| Endotoxin | <0.1 EU/μg | 0.5-2 EU/μg | Safe for cell culture |
| Stability | 24 months at -20°C | 12 months | Longer shelf life |
| COA | Full documentation | Basic certificate | Traceable quality |
Bulk Purchase Selection Guide
Common pitfalls when sourcing BNP peptide include accepting vague purity claims, ignoring endotoxin levels for cell-based assays, and failing to verify sequence identity. Selection standards require requesting batch-specific COA, confirming HPLC chromatogram, and checking storage conditions. Buyer checklist: request MS spectrum, verify purity threshold, confirm endotoxin level, check storage temperature, and review third-party test reports.
- Purity Verification: Always request HPLC chromatogram with peak integration data.
- Endotoxin Check: For cell culture, require <0.1 EU/μg certificate.
- Batch Consistency: Request COA for each batch to ensure reproducibility.
Core Product Advantages
Our BNP peptide delivers ≥99% purity verified by independent HPLC, ensuring consistent results in ELISA and Western blot applications. Stability is guaranteed with 24-month shelf life at -20°C, reducing waste from degradation. Cost performance is optimized through direct manufacturing, offering 15-20% savings over distributor prices. Technical support includes free reconstitution protocols and application notes for assay optimization.
Frequently Asked Questions
Q1: What is the recommended storage condition for BNP peptide after reconstitution?
After reconstitution in sterile water or buffer, store at 4°C for up to 7 days. For longer storage, aliquot and freeze at -20°C for up to 6 months. Avoid repeated freeze-thaw cycles to maintain activity.
Q2: How do I verify the purity of BNP peptide from a supplier?
Request the Certificate of Analysis (COA) including HPLC chromatogram showing a single peak at retention time, mass spectrometry confirming molecular weight, and amino acid analysis matching theoretical composition. Third-party testing adds credibility.
Q3: Can BNP peptide be used in cell culture experiments?
Yes, provided the endotoxin level is below 0.1 EU/μg. Always verify the certificate and perform a pilot test at low concentrations (1-10 nM) to confirm no cytotoxic effects. Use sterile techniques during reconstitution.