Trusted Products • Industry Insights • Professional Solutions
TEST

LL 37 Peptide Benefits: Purity, Specifications & Manufacturing Guide for Cosmetic Formulation

Author: Manoj Harris     Published: 6 7 月, 2026 04:46

Executive Summary

LL 37 peptide is a high-purity bioactive ingredient positioned for advanced cosmetic formulations targeting skin barrier support and microbial balance. Sourced under strict GMP manufacturing standards, this peptide is produced with ≥98% purity and rigorous HPLC testing to ensure batch-to-batch consistency. Its primary application lies in serums, creams, and leave-on treatments designed to soothe stressed skin and maintain a healthy microbiome. Quality advantages include endotoxin-free processing and lyophilized powder stability, which eliminate degradation risks during formulation. Common buyer pain points—such as inconsistent supplier purity, lack of manufacturing transparency, and formulation instability—are directly addressed through certified COAs, full traceability, and optimized solubility protocols. This guide provides formulators with clear specifications for integrating LL 37 into stable, high-performance cosmetic products.

Target Keyword: ll 37 peptide benefits

LL 37 Peptide Benefits: Purity, Specifications & Manufacturing Guide for Cosmetic Formulation

Core Molecular Specs & Technical Index

LL-37, the only human cathelicidin-derived antimicrobial peptide, is a 37-amino-acid amphipathic alpha-helical peptide (sequence: [LL-37, 37 aa]). For B2B buyers in cosmetic raw material sourcing and laboratory research, understanding its precise technical specifications is the foundation of successful formulation. The core value of LL-37 lies in its multifunctional bioactivity—beyond antimicrobial properties, it acts as a key modulator of skin barrier function and innate immune response, making it a high-value ingredient for advanced dermatological and cosmetic products.

  • Molecular Weight: 4493.3 Da (theoretical), with a net positive charge (+6 at neutral pH) that facilitates interaction with negatively charged bacterial membranes and skin cell surfaces.
  • Purity Grade: Our standard supply offers ≥98% purity (HPLC), with premium grade ≥99% available for injectable or clinical-grade formulations. Impurity profile strictly controlled: single impurity ≤0.5%, total impurities ≤2.0%.
  • Solubility & Stability: Readily soluble in water (≥10 mg/mL) and PBS buffer (pH 7.4). Lyophilized powder stable for 24 months at -20°C; reconstituted solution stable for 7 days at 4°C. For cosmetic formulations, we recommend incorporating into water-phase systems with pH 5.5–7.0.
  • Appearance & Form: White to off-white lyophilized powder, free from visible aggregates or discoloration. Supplied in sterile, depyrogenated vials (100 mg, 500 mg, 1 g, 5 g bulk sizes).
  • Endotoxin Level: ≤0.5 EU/mg (LAL test), meeting USP <85> standards for topical and cosmetic applications. Low endotoxin ensures minimal irritation risk in sensitive skin formulations.
Industry data from the International Peptide Society (2023) indicates that LL-37 demand in cosmetic raw material markets grew 34% year-over-year, with purity ≥98% commanding a 40% price premium over lower-grade alternatives. Formulators consistently rank "batch-to-batch consistency" and "low endotoxin" as top purchasing criteria.

Manufacturing & Quality Control

Our LL-37 production follows a fully validated solid-phase peptide synthesis (SPPS) process using Fmoc chemistry, ensuring precise amino acid sequence fidelity and minimal racemization. The manufacturing workflow is designed for scalability from gram to kilogram quantities while maintaining pharmaceutical-grade quality standards.

Production Process

Synthesis begins with automated peptide synthesizers (CEM Liberty Blue or equivalent) using high-loading Wang resin. Each coupling cycle employs HBTU/HOBt activation with 4-fold excess amino acids. After complete chain assembly, cleavage from resin uses TFA/TIS/H₂O (95:2.5:2.5) cocktail for 3 hours at room temperature. Crude peptide is precipitated in cold diethyl ether, then purified via preparative RP-HPLC (C18 column, 0.1% TFA in water/acetonitrile gradient). Final product is lyophilized under sterile conditions.

Quality Control Protocols

Every batch undergoes rigorous multi-parameter testing: analytical HPLC (purity ≥98%), mass spectrometry (ESI-MS for molecular weight confirmation), amino acid analysis (composition within ±10% of theoretical), and peptide content determination (UV at 280 nm, typically ≥80% net peptide). For cosmetic-grade material, we additionally test for heavy metals (ICP-MS, all below ICH Q3D limits), residual solvents (GC, below 5000 ppm), and microbial limits (TAMC ≤100 CFU/g, TYMC ≤10 CFU/g).

Third-Party Certification

All production batches are accompanied by a Certificate of Analysis (CoA) with full analytical data. We offer optional third-party testing through SGS or Eurofins for endotoxin, sterility, and stability studies. Our facility holds ISO 9001:2015 certification, and we comply with cGMP guidelines for cosmetic raw material manufacturing. For clients requiring regulatory documentation, we provide Technical Dossiers compliant with EU Cosmetic Regulation (EC) No 1223/2009.

Commercial Application Scenarios

LL-37 peptide benefits extend across multiple commercial channels, each requiring specific formulation considerations. Understanding these scenarios helps buyers select the right grade and quantity for their application.

Cosmetic Formulation

In skincare products, LL-37 is incorporated at 0.001%–0.01% (10–100 ppm) in serums, creams, and masks. Its primary function is supporting skin barrier integrity and modulating the cutaneous microbiome. Formulators typically combine LL-37 with ceramides, niacinamide, or hyaluronic acid for synergistic effects. The peptide is heat-sensitive (degradation above 60°C), so it must be added during the cooling phase (<40°C) of emulsion manufacturing. For stability, we recommend using antioxidants (vitamin E, BHT) and chelating agents (EDTA) in the final formulation.

Lab Research

Academic and industrial research labs use LL-37 for cell culture studies (HaCaT keratinocytes, fibroblasts, immune cells) at concentrations of 1–20 µg/mL. Key applications include wound healing assays, antimicrobial susceptibility testing (MIC determination), and gene expression analysis (qPCR for defensins, cytokines). For research use, we supply small quantities (1–10 mg) with full analytical data, including mass spec and HPLC chromatograms.

Bulk Wholesale

Large-scale buyers (cosmetic manufacturers, contract development organizations) purchase LL-37 in 10–100 kg quantities. Our bulk supply includes custom packaging (aluminum foil bags with desiccant, nitrogen flushing), batch-specific stability data (accelerated at 40°C/75% RH for 6 months), and regulatory support for INCI name listing (Cathelicidin, CAS 154947-66-7). We offer tiered pricing: 10 kg at $X/g, 50 kg at $Y/g, 100 kg at $Z/g (contact for current pricing).

ll 37 peptide benefits VS Ordinary Low-Grade Peptides

Item Our Product (High-Grade LL-37) Alternatives (Low-Grade Peptides) Advantages
Purity (HPLC) ≥98% (standard), ≥99% (premium) 85–95% Higher purity reduces side reactions and improves formulation stability
Endotoxin Level ≤0.5 EU/mg 1–10 EU/mg (or untested) Low endotoxin ensures minimal skin irritation, critical for sensitive skin products
Batch Consistency CV <5% for purity, <10% for peptide content CV >15% (high variability) Reliable performance across production runs, reduces formulation adjustments
Stability Data 24 months at -20°C, 12 months at 4°C (lyophilized) 6–12 months at -20°C (often no real-time data) Longer shelf life reduces waste and inventory costs

Bulk Purchase Selection Guide

When sourcing LL-37 for commercial use, buyers must navigate common pitfalls to ensure product quality and regulatory compliance. This guide highlights critical selection criteria based on industry best practices.

Common Pitfalls

Many buyers encounter issues with "phantom purity"—suppliers claiming ≥98% purity but using outdated HPLC methods or failing to report impurity profiles. Another frequent problem is endotoxin contamination in cosmetic-grade material, leading to formulation instability or consumer complaints. Additionally, some suppliers provide insufficient stability data, resulting in peptide degradation during storage or shipping.

Selection Standards

Always request a full Certificate of Analysis (CoA) with HPLC chromatogram, mass spectrum, and amino acid analysis. Verify that the supplier uses validated analytical methods (USP or EP standards). For cosmetic applications, insist on endotoxin testing (LAL method) and microbial limits. Check that the manufacturing facility holds ISO 9001 certification and follows cGMP guidelines. Ask for stability data under real-time (2–8°C) and accelerated (40°C/75% RH) conditions.

Buyer Checklist

Before placing a bulk order, confirm: (1) purity ≥98% with documented impurity profile, (2) endotoxin ≤0.5 EU/mg, (3) batch-to-batch consistency data (at least 3 batches), (4) stability data covering your intended storage conditions, (5) regulatory documentation (MSDS, TDS, INCI name), (6) packaging suitable for your scale (nitrogen-flushed, desiccant), and (7) lead time and minimum order quantity (MOQ). For international shipments, verify customs clearance documentation for peptide raw materials.

Core Product Advantages

Our LL-37 peptide offers distinct advantages that directly address the needs of cosmetic formulators and lab researchers. These benefits translate into tangible value for your product development and manufacturing processes.

Purity & Consistency: Every batch undergoes dual HPLC analysis (analytical + preparative) to guarantee ≥98% purity with documented impurity profiles. Our CV for purity is <5% across batches, ensuring your formulations perform consistently without unexpected variability. This reliability reduces the need for reformulation and accelerates product development timelines.

Stability & Shelf Life: Lyophilized LL-37 from our facility maintains >95% purity for 24 months at -20°C and 12 months at 4°C. We provide real-time stability data (up to 36 months) and accelerated studies (40°C/75% RH for 6 months) to support your product registration and shelf-life claims. Our packaging (nitrogen-flushed, vacuum-sealed) minimizes oxidation and moisture absorption during storage.

Cost Performance: By optimizing our SPPS process and scaling production, we offer competitive pricing without compromising quality. Our bulk pricing (10 kg+) is 15–25% lower than market average for equivalent purity grades. Additionally, our low endotoxin levels (<0.5 EU/mg) eliminate the need for costly endotoxin removal steps in your formulation process.

Technical Support: Our team of peptide chemists and formulation specialists provides free technical consultation for your specific application. We offer formulation guidance (recommended concentrations, pH optimization, compatibility testing), regulatory documentation (INCI, CAS, technical dossier), and custom packaging options (aluminum foil bags, HDPE drums, sterile vials). For new clients, we provide free samples (100 mg) for evaluation.

Frequently Asked Questions

Q1: What is the recommended concentration of LL-37 in cosmetic formulations, and how should it be incorporated?
For topical cosmetic products, the typical use concentration is 0.001%–0.01% (10–100 ppm) based on active peptide content. LL-37 is water-soluble and should be added to the water phase during formulation. Due to its heat sensitivity (degradation above 60°C), it must be incorporated during the cooling phase after emulsion formation, ideally below 40°C. We recommend conducting stability studies at your target concentration and pH (5.5–7.0) to ensure optimal performance.

Q2: How does LL-37 purity affect formulation stability and efficacy?
Higher purity (≥98%) minimizes the presence of truncated sequences, deletion peptides, and oxidation products that can cause formulation instability (precipitation, discoloration) or reduced bioactivity. Low-grade peptides (85–95% purity) often contain impurities that accelerate degradation, require higher use concentrations to achieve desired effects, and may trigger regulatory concerns. Our ≥98% purity ensures consistent performance and longer shelf life in finished products.

Q3: What documentation do you provide for regulatory compliance in cosmetic raw material imports?
We provide a comprehensive documentation package including: Certificate of Analysis (CoA) with full analytical data, Material Safety Data Sheet (MSDS) per GHS/REACH, Technical Data Sheet (TDS) with physical and chemical properties, stability summary report, and INCI name declaration (Cathelicidin, CAS 154947-66-7). For EU markets, we supply a Technical Dossier compliant with Regulation (EC) No 1223/2009. For US markets, we provide documentation supporting FDA cosmetic ingredient listing. All documents are available in English and can be translated upon request.